Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli fadL protein

This E. coli fadL protein spans the amino acid sequence from region 26-446aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Outer membrane FadL protein Outer membrane flp protein

UniProt

Q8XCN6

Expression Region

26-446aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Escherichia coli O157:H7

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

61.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AGFQLNEFSSSGLGRAYSGEGAIADDAGNVSRNPALITMFDRPTFSAGAVYIDPDVNISGTSPSGRSLKADNIAPTAWVPNMHFVAPINDQFGWGASITSNYGLATEFNDTYAGGSVGGTTDLETMNLNLSGAYRLNNAWSFGLGFNAVYARAKIERFAGDLGQLVAGQIMQSPAGKTPQGQALAATANGIDSNTKIAHLNGNQWGFGWNAGILYELDKNNRYALTYRSEVKIDFKGNYSSDLNRVFNNYGLPIPTATGGATQSGYLTLNLPEMWEVSGYNRVDPQWAIHYSLAYTSWSQFQQLKATSTSGDTLFQKHEGFKDAYRIALGTTYYYDDNWTFRTGIAFDDSPVPAQNRSISIPDQDRFWLSAGTTYAFNKDASVDVGVSYMHGQSVKINEGPYQFESEGKAWLFGTNFNYAF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-RAB11B antibody
STJ117545 100 µl

Anti-RAB11B antibody

Sign In for Pricing
View Details
AKAP9 Polyclonal Antibody
E44H07750 100 µL

AKAP9 Polyclonal Antibody

Sign In for Pricing
View Details
BAY-1895344 10mM * 1mL in DMSO
A19454-10mM-D 10 mM x 1mL in DMSO

BAY-1895344 10mM * 1mL in DMSO

Sign In for Pricing
View Details
Darolutamide D4
CS-EO-02045 1 Each

Darolutamide D4

Sign In for Pricing
View Details
Rat CCAAT/enhancer-binding protein zeta (CEBPZ) ELISA Kit
MBS7202798-01 48 Well

Rat CCAAT/enhancer-binding protein zeta (CEBPZ) ELISA Kit

Sign In for Pricing
View Details
Rat CCAAT/enhancer-binding protein zeta (CEBPZ) ELISA Kit
MBS7202798-02 96 Well

Rat CCAAT/enhancer-binding protein zeta (CEBPZ) ELISA Kit

Sign In for Pricing
View Details