Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plant SH-1 protein

This Plant SH-1 protein spans the amino acid sequence from region 555-802aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Shrunken-1 Sucrose-UDP glucosyltransferase 1

UniProt

P04712

Expression Region

555-802aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Zea mays (Maize)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NSEHKFVLKDKKKPIIFSMARLDRVKNMTGLVEMYGKNARLRELANLVIVAGDHGKESKDREEQAEFKKMYSLIDEYKLKGHIRWISAQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVIESMTCGLPTIATCHGGPAEIIVDGVSGLHIDPYHSDKAADILVNFFDKCKADPSYWDEISQGGLQRIYEKYTWKLYSERLMTLTGVYGFWKYVSNLERRETRRYIEMFYALKYRSLASQVPLSFD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Artery: peripheral
CS802752 5x 5 µm

Tissue FFPE Sections, Artery: peripheral

Sign In for Pricing
View Details
Human Programmed Cell Death Protein 1 Ligand 1 (PDCD1LG1) ELISA Kit
RDR-PDCD1LG1-Hu-01 96 Tests

Human Programmed Cell Death Protein 1 Ligand 1 (PDCD1LG1) ELISA Kit

Sign In for Pricing
View Details
Human Programmed Cell Death Protein 1 Ligand 1 (PDCD1LG1) ELISA Kit
RDR-PDCD1LG1-Hu-02 48 Tests

Human Programmed Cell Death Protein 1 Ligand 1 (PDCD1LG1) ELISA Kit

Sign In for Pricing
View Details
ADFP/PLIN2 Recombinant Rabbit Monoclonal Antibody [JA31-81]
ET1704-17 100 µL

ADFP/PLIN2 Recombinant Rabbit Monoclonal Antibody [JA31-81]

Sign In for Pricing
View Details
Nandrolone 17-Propionate
TRC-N315050-500MG 500 mg

Nandrolone 17-Propionate

Sign In for Pricing
View Details
C-Jun (Ab-73) Antibody
8B7046-AAT 50 µg

C-Jun (Ab-73) Antibody

Sign In for Pricing
View Details