Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plant SH-1 protein

This Plant SH-1 protein spans the amino acid sequence from region 555-802aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Shrunken-1 Sucrose-UDP glucosyltransferase 1

UniProt

P04712

Expression Region

555-802aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Zea mays (Maize)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NSEHKFVLKDKKKPIIFSMARLDRVKNMTGLVEMYGKNARLRELANLVIVAGDHGKESKDREEQAEFKKMYSLIDEYKLKGHIRWISAQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVIESMTCGLPTIATCHGGPAEIIVDGVSGLHIDPYHSDKAADILVNFFDKCKADPSYWDEISQGGLQRIYEKYTWKLYSERLMTLTGVYGFWKYVSNLERRETRRYIEMFYALKYRSLASQVPLSFD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Myometrium
CS504795 5x 5 µm

Frozen Tissue Sections, Myometrium

Sign In for Pricing
View Details
Fmoc-Asp (t-Bu) TentaGel® R HMPA Resin
RA1505.1G 1 g

Fmoc-Asp (t-Bu) TentaGel® R HMPA Resin

Sign In for Pricing
View Details
N-Acetyl-d3-L-threonine-2,3-d2
TRC-A192014-50MG 50 mg

N-Acetyl-d3-L-threonine-2,3-d2

Sign In for Pricing
View Details
IRF5 (NM_001098631) Human Recombinant Protein
TP316039M 100 µg

IRF5 (NM_001098631) Human Recombinant Protein

Sign In for Pricing
View Details
Psma2 Mouse Gene Knockout Kit (CRISPR)
KN514090 1 Kit

Psma2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NCAPG2 Antibody
8C15236-AAT 50 µg

NCAPG2 Antibody

Sign In for Pricing
View Details