Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Acaca protein

This Rat Acaca protein spans the amino acid sequence from region 116-617aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ACC-alpha

UniProt

P11497

Expression Region

116-617aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

59.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VIEKVLIANNGIAAVKCMRSIRRWSYEMFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPGGANNNNYANVELILDIAKRIPVQAVWAGWGHASENPKLPELLLKNGIAFMGPPSQAMWALGDKIASSIVAQTAGIPTLPWSGSGLRVDWQENDFSKRILNVPQDLYEKGYVKDVDDGLKAAEEVGYPVMIKASEGGGGKGIRKVNNADDFPNLFRQVQAEVPGSPIFVMRLAKQSRHLEVQILADQYGNAISLFGRDCSVQRRHQKIIEEAPAAIATPAVFEHMEQCAVKLAKMVGYVSAGTVEYLYSQDGSFYFLELNPRLQVEHPCTEMVADVNLPAAQLQIAMGIPLFRIKDIRMMYGVSPWGDAPIDFENSAHVPCPRGHVIAARITSENPDEGFKPSSGTVQELNFRSNKNVWGYFSVAAAGGLHEFADSQFGHCFSWGENREEAISNMVVALKELSIRGDFRTTVEYLIKLLETESFQLNRIDTGWLDRLIA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyp2d12 Protein Vector (Mouse) (pPM-C-HA)
17398024 500 ng

Cyp2d12 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
SLC18A2 Antibody, Biotin conjugated
A34863-50UG 50 µg

SLC18A2 Antibody, Biotin conjugated

Sign In for Pricing
View Details
FOLH2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0793506 1.0 µg DNA

FOLH2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Human DHX38 shRNA Plasmid
abx956547-01 150 µg

Human DHX38 shRNA Plasmid

Sign In for Pricing
View Details
Human DHX38 shRNA Plasmid
abx956547-02 300 µg

Human DHX38 shRNA Plasmid

Sign In for Pricing
View Details
MIL 1RA His Recombinant Protein
32-1378-20 20 µg

MIL 1RA His Recombinant Protein

Sign In for Pricing
View Details