Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Acaca protein

This Rat Acaca protein spans the amino acid sequence from region 116-617aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ACC-alpha

UniProt

P11497

Expression Region

116-617aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

59.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VIEKVLIANNGIAAVKCMRSIRRWSYEMFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPGGANNNNYANVELILDIAKRIPVQAVWAGWGHASENPKLPELLLKNGIAFMGPPSQAMWALGDKIASSIVAQTAGIPTLPWSGSGLRVDWQENDFSKRILNVPQDLYEKGYVKDVDDGLKAAEEVGYPVMIKASEGGGGKGIRKVNNADDFPNLFRQVQAEVPGSPIFVMRLAKQSRHLEVQILADQYGNAISLFGRDCSVQRRHQKIIEEAPAAIATPAVFEHMEQCAVKLAKMVGYVSAGTVEYLYSQDGSFYFLELNPRLQVEHPCTEMVADVNLPAAQLQIAMGIPLFRIKDIRMMYGVSPWGDAPIDFENSAHVPCPRGHVIAARITSENPDEGFKPSSGTVQELNFRSNKNVWGYFSVAAAGGLHEFADSQFGHCFSWGENREEAISNMVVALKELSIRGDFRTTVEYLIKLLETESFQLNRIDTGWLDRLIA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Indacaterol maleate
abx283569-01 10 mg

Indacaterol maleate

Sign In for Pricing
View Details
Indacaterol maleate
abx283569-02 50 mg

Indacaterol maleate

Sign In for Pricing
View Details
Rabbit Pigment Epithelium Derived Factor (PEDF) ELISA Kit
MBS2122058-01 24 Strip Well

Rabbit Pigment Epithelium Derived Factor (PEDF) ELISA Kit

Sign In for Pricing
View Details
Rabbit Pigment Epithelium Derived Factor (PEDF) ELISA Kit
MBS2122058-02 48 Well

Rabbit Pigment Epithelium Derived Factor (PEDF) ELISA Kit

Sign In for Pricing
View Details
Rabbit Pigment Epithelium Derived Factor (PEDF) ELISA Kit
MBS2122058-03 96 Well

Rabbit Pigment Epithelium Derived Factor (PEDF) ELISA Kit

Sign In for Pricing
View Details
Rabbit Pigment Epithelium Derived Factor (PEDF) ELISA Kit
MBS2122058-04 5x 96 Well

Rabbit Pigment Epithelium Derived Factor (PEDF) ELISA Kit

Sign In for Pricing
View Details