Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TREM2 protein

This Human TREM2 protein spans the amino acid sequence from region 19-174aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Triggering receptor expressed on monocytes 2

UniProt

Q9NZC2

Expression Region

19-174aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nuclear Transcription Factor Y Subunit Alpha (NFYA) Antibody
abx329378-01 50 µg

Nuclear Transcription Factor Y Subunit Alpha (NFYA) Antibody

Sign In for Pricing
View Details
Nuclear Transcription Factor Y Subunit Alpha (NFYA) Antibody
abx329378-02 100 µg

Nuclear Transcription Factor Y Subunit Alpha (NFYA) Antibody

Sign In for Pricing
View Details
N-Methylbutane-1,4-diamine, Dihydrochloride-13C, 15N
459477-01 1 mg

N-Methylbutane-1,4-diamine, Dihydrochloride-13C, 15N

Sign In for Pricing
View Details
N-Methylbutane-1,4-diamine, Dihydrochloride-13C, 15N
459477-02 2 mg

N-Methylbutane-1,4-diamine, Dihydrochloride-13C, 15N

Sign In for Pricing
View Details
HEBP1 Knockout NCI-H1975 Polyclonal Cells
ARG31612 1 Million

HEBP1 Knockout NCI-H1975 Polyclonal Cells

Sign In for Pricing
View Details
Guinea Pig Galectin-4 (LGALS4) ELISA kit
GTR10380006 96 Well

Guinea Pig Galectin-4 (LGALS4) ELISA kit

Sign In for Pricing
View Details