Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plant SUS1 protein

This Plant SUS1 protein spans the amino acid sequence from region 1-218aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sucrose-UDP glucosyltransferase

UniProt

P31925

Expression Region

1-218aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Saccharum officinarum (Sugarcane)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ARLDRVKNMTGPVEISGKKARLRELANPVIVAGDHGKESKDRDEAEEQGGFKKMYSLIDDYKFKGHIRLISAQMNRVRNGELYQYICDTKGAFVQPAYEAFRLDCDRVHEVRSAKDRDLPWRPCEIIADGVSGLHIDPYHSDKDADILVNFFDKCNADPSYWDEISQGGQRIYEKYTWKLYSERLMTLTGAYGFWNYVSKLERGDTRYIDMFYALEYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Prkx activation kit by CRISPRa
GA203387 1 Kit

Mouse Prkx activation kit by CRISPRa

Sign In for Pricing
View Details
Evinacumab Biosimilar - Research Grade
ICH5151-50mg 50 mg

Evinacumab Biosimilar - Research Grade

Sign In for Pricing
View Details
Hematin
TRC-H235303-500MG 500 mg

Hematin

Sign In for Pricing
View Details
MPO Antibody
OC-334-01 50 μL

MPO Antibody

Sign In for Pricing
View Details
MPO Antibody
OC-334-02 100 µL

MPO Antibody

Sign In for Pricing
View Details
MPO Antibody
OC-334-03 1 mL

MPO Antibody

Sign In for Pricing
View Details