Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Txndc12 protein

This Mouse Txndc12 protein spans the amino acid sequence from region 25-170aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Endoplasmic reticulum resident protein 19 Short name, ER protein 19 Short name, ERp19 Thioredoxin-like protein p19

UniProt

Q9CQU0

Expression Region

25-170aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RTGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPRDEDFSPDGGYIPRILFLDPSGKVRPEIINESGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFREKHFQDEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gm7849 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K3335602 1.0 µg DNA

Gm7849 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Bag-5 (h) -PR
sc-72604-PR 10 µM - 20 µL

Bag-5 (h) -PR

Sign In for Pricing
View Details
OCIAD1, CT (OCIAD1, OCIA, OCIA domain-containing protein 1, Ovarian carcinoma immunoreactive antigen) (MaxLight 490)
MBS6327541-01 0.1 mL

OCIAD1, CT (OCIAD1, OCIA, OCIA domain-containing protein 1, Ovarian carcinoma immunoreactive antigen) (MaxLight 490)

Sign In for Pricing
View Details
OCIAD1, CT (OCIAD1, OCIA, OCIA domain-containing protein 1, Ovarian carcinoma immunoreactive antigen) (MaxLight 490)
MBS6327541-02 5x 0.1 mL

OCIAD1, CT (OCIAD1, OCIA, OCIA domain-containing protein 1, Ovarian carcinoma immunoreactive antigen) (MaxLight 490)

Sign In for Pricing
View Details
Rabbit Polyclonal KLHL34 Antibody [FITC]
NBP2-98044F 0.1 mL

Rabbit Polyclonal KLHL34 Antibody [FITC]

Sign In for Pricing
View Details
Human Ephrin B1 Antibody
33295-05111 150 µg

Human Ephrin B1 Antibody

Sign In for Pricing
View Details