Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Txndc12 protein

This Mouse Txndc12 protein spans the amino acid sequence from region 25-170aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Endoplasmic reticulum resident protein 19 Short name, ER protein 19 Short name, ERp19 Thioredoxin-like protein p19

UniProt

Q9CQU0

Expression Region

25-170aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RTGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPRDEDFSPDGGYIPRILFLDPSGKVRPEIINESGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFREKHFQDEL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fbxo5 ORF Vector (Rat) (pORF)
20343016 1.0 µg DNA

Fbxo5 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Wnt11 Antibody Blocking Peptide
orb1501086 500 µg

Wnt11 Antibody Blocking Peptide

Sign In for Pricing
View Details
Goat Charged multivesicular body protein 7 (CHMP7) ELISA kit
GTR10452811 96 Well

Goat Charged multivesicular body protein 7 (CHMP7) ELISA kit

Sign In for Pricing
View Details
PPP1R15B 3'UTR Lenti-reporter-Luc Vector
37420081 1.0 µg

PPP1R15B 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
LILRB2 Antibody, Biotin conjugated
A27592-100UL 100 µL

LILRB2 Antibody, Biotin conjugated

Sign In for Pricing
View Details
EMR4 discontinued
388713 200 µL

EMR4 discontinued

Sign In for Pricing
View Details