Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Txndc12 protein

This Mouse Txndc12 protein spans the amino acid sequence from region 25-170aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Endoplasmic reticulum resident protein 19 Short name, ER protein 19 Short name, ERp19 Thioredoxin-like protein p19

UniProt

Q9CQU0

Expression Region

25-170aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RTGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPRDEDFSPDGGYIPRILFLDPSGKVRPEIINESGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFREKHFQDEL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GARP&Latent TGF Beta 2 Complex, Human (HEK293, His-Avi)
HY-P700857 1 Each

GARP&Latent TGF Beta 2 Complex, Human (HEK293, His-Avi)

Sign In for Pricing
View Details
Mouse Monoclonal RALBP1 Antibody (OTI11B2) [Biotin]
NBP2-73788B 0.1 mL

Mouse Monoclonal RALBP1 Antibody (OTI11B2) [Biotin]

Sign In for Pricing
View Details
CCR5 (NT) (Chemokine Receptor 5, CC-CKR-5, CD195) (MaxLight 650) discontinued
C2099-97-ML650 100 µL

CCR5 (NT) (Chemokine Receptor 5, CC-CKR-5, CD195) (MaxLight 650) discontinued

Sign In for Pricing
View Details
EGFR Monoclonal Antibody
MBS2580134-01 1.5 mL

EGFR Monoclonal Antibody

Sign In for Pricing
View Details
EGFR Monoclonal Antibody
MBS2580134-02 3 mL

EGFR Monoclonal Antibody

Sign In for Pricing
View Details
EGFR Monoclonal Antibody
MBS2580134-03 6 mL

EGFR Monoclonal Antibody

Sign In for Pricing
View Details