Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human AGTR2 protein

This Human AGTR2 protein spans the amino acid sequence from region 1-45aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Angiotensin II type-2 receptor Short name, AT2

UniProt

P50052

Expression Region

1-45aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKGNSTLATTSKNITSGLHFGLVNISGNNESTLNCSQKPSDKHLD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DDX20 (DP103; GEMIN3)
368696 100 µL

DDX20 (DP103; GEMIN3)

Sign In for Pricing
View Details
Deoxyfuconojirimycin hydrochloride
orb1745127-01 25 mg

Deoxyfuconojirimycin hydrochloride

Sign In for Pricing
View Details
Deoxyfuconojirimycin hydrochloride
orb1745127-02 50 mg

Deoxyfuconojirimycin hydrochloride

Sign In for Pricing
View Details
Deoxyfuconojirimycin hydrochloride
orb1745127-03 100 mg

Deoxyfuconojirimycin hydrochloride

Sign In for Pricing
View Details
TADA2B Rabbit Polyclonal Antibody (HRP)
orb2084951 100 µL

TADA2B Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
GABRA2, CT (GABRA2, Gamma-aminobutyric acid receptor subunit alpha-2, GABA(A) receptor subunit alpha-2) (MaxLight 405)
MBS6300834-01 0.1 mL

GABRA2, CT (GABRA2, Gamma-aminobutyric acid receptor subunit alpha-2, GABA(A) receptor subunit alpha-2) (MaxLight 405)

Sign In for Pricing
View Details