Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human AGTR2 protein

This Human AGTR2 protein spans the amino acid sequence from region 1-45aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Angiotensin II type-2 receptor Short name, AT2

UniProt

P50052

Expression Region

1-45aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKGNSTLATTSKNITSGLHFGLVNISGNNESTLNCSQKPSDKHLD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human KAT5 sgRNA gene knockout kit - Lentiviral human KAT5 sgRNA gene knockout kit (plasmid)
GTR15373049 1 Vial

Lentiviral human KAT5 sgRNA gene knockout kit - Lentiviral human KAT5 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Zfp619 Protein Vector (Mouse) (pPB-N-His)
PV249863 500 ng

Zfp619 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
HS6ST3 Rabbit Polyclonal Antibody
orb325442 100 µL

HS6ST3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Monkey TP63 (Tumor Protein p63) ELISA Kit
MBS2502846-01 24 Tests

Monkey TP63 (Tumor Protein p63) ELISA Kit

Sign In for Pricing
View Details
Monkey TP63 (Tumor Protein p63) ELISA Kit
MBS2502846-02 48 Tests

Monkey TP63 (Tumor Protein p63) ELISA Kit

Sign In for Pricing
View Details
Monkey TP63 (Tumor Protein p63) ELISA Kit
MBS2502846-03 96 Tests

Monkey TP63 (Tumor Protein p63) ELISA Kit

Sign In for Pricing
View Details