Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human AGTR2 protein

This Human AGTR2 protein spans the amino acid sequence from region 1-45aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Angiotensin II type-2 receptor Short name, AT2

UniProt

P50052

Expression Region

1-45aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKGNSTLATTSKNITSGLHFGLVNISGNNESTLNCSQKPSDKHLD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CMTM3 siRNA (Human)
orb1853512-01 15 nmol

CMTM3 siRNA (Human)

Sign In for Pricing
View Details
CMTM3 siRNA (Human)
orb1853512-02 30 nmol

CMTM3 siRNA (Human)

Sign In for Pricing
View Details
Tau Peptide (306-317)
4099429.1000 1 mg

Tau Peptide (306-317)

Sign In for Pricing
View Details
TAAR1 Antibody
orb1250526 0.05 mg

TAAR1 Antibody

Sign In for Pricing
View Details
Anti-LMO2 Antibody Picoband®
A03502-2 100 µg/Vial

Anti-LMO2 Antibody Picoband®

Sign In for Pricing
View Details
1- (3-Methylbenzyl) piperazine
HY-W015160-01 500 mg

1- (3-Methylbenzyl) piperazine

Sign In for Pricing
View Details