Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fungi DDP1 protein

This Fungi DDP1 protein spans the amino acid sequence from region 2-188aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Diadenosine 5',5'''-P1, P6-hexaphosphate hydrolase Short name, Ap6A hydrolase Diadenosine and diphosphoinositol polyphosphate phosphohydrolase 1 Diadenosine hexaphosphate hydrolase (AMP-forming)

UniProt

Q99321

Expression Region

2-188aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GKTADNHGPVRSETAREGRENQVYSPVTGARLVAGCICLTPDKKQVLMITSSAHKKRWIVPKGGVEKDEPNYETTAQRETWEEAGCIGKIVANLGTVEDMRPPKDWNKDIKQFENSRKDSEVAKHPPRTEFHFYELEIENLLDKFPECHKRHRKLYSYTEAKQNLIDAKRPELLEALNRSAIIKDDK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tmbim6 Mouse Gene Knockout Kit (CRISPR)
KN517656 1 Kit

Tmbim6 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
alpha 1b Adrenergic Receptor (ADRA1B) Human Gene Knockout Kit (CRISPR)
KN423974 1 Kit

alpha 1b Adrenergic Receptor (ADRA1B) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ZNF841 (N-term) Rabbit Polyclonal Antibody
AP54728PU-N 400 µL

ZNF841 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Colloidal Gold Conjugated Sophora japonica (Pagoda Tree) -SJA-, 1mL 40nm
GP-2901-40 1 mL

Colloidal Gold Conjugated Sophora japonica (Pagoda Tree) -SJA-, 1mL 40nm

Sign In for Pricing
View Details
Myristoyl-L-carnitine-d3 Hydrochloride
TRC-M884747-25MG 25 mg

Myristoyl-L-carnitine-d3 Hydrochloride

Sign In for Pricing
View Details
Tnks2 Mouse Gene Knockout Kit (CRISPR)
KN518013 1 Kit

Tnks2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details