Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pig PMAP36 protein

This Pig PMAP36 protein spans the amino acid sequence from region 130-166aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Myeloid antibacterial peptide 36

UniProt

P49931

Expression Region

130-166aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VGRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CCKAR Antibody
MBS9240233-01 0.05 mL

Anti-CCKAR Antibody

Sign In for Pricing
View Details
Anti-CCKAR Antibody
MBS9240233-02 0.1 mL

Anti-CCKAR Antibody

Sign In for Pricing
View Details
Anti-CCKAR Antibody
MBS9240233-03 5x 0.1 mL

Anti-CCKAR Antibody

Sign In for Pricing
View Details
Anti-SFRP4 Antibody
CQA2229-01 30 µL

Anti-SFRP4 Antibody

Sign In for Pricing
View Details
Anti-SFRP4 Antibody
CQA2229-02 50 μL

Anti-SFRP4 Antibody

Sign In for Pricing
View Details
Anti-SFRP4 Antibody
CQA2229-03 100 µL

Anti-SFRP4 Antibody

Sign In for Pricing
View Details