Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Insect Glutathione S-transferase protein

This Insect Glutathione S-transferase protein spans the amino acid sequence from region 2-204aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GST class-sigma Major allergen Bla g 5 Allergen, Bla g 5

UniProt

O18598

Expression Region

2-204aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Blattella germanica (German cockroach) (Blatta germanica)

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APSYKLTYCPVKALGEPIRFLLSYGEKDFEDYRFQEGDWPNLKPSMPFGKTPVLEIDGKQTHQSVAISRYLGKQFGLSGKDDWENLEIDMIVDTISDFRAAIANYHYDADENSKQKKWDPLKKETIPYYTKKFDEVVKANGGYLAAGKLTWADFYFVAILDYLNHMAKEDLVANQPNLKALREKVLGLPAIKAWVAKRPPTDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PKC mu (PRKD1) Rabbit Polyclonal Antibody
AP06569PU-N 100 µg

PKC mu (PRKD1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse S1pr1 activation kit by CRISPRa
GA201174 1 Kit

Mouse S1pr1 activation kit by CRISPRa

Sign In for Pricing
View Details
ASK1 (MAP3K5) (NM_005923) Human Over-expression Lysate
LY401794 100 µg

ASK1 (MAP3K5) (NM_005923) Human Over-expression Lysate

Sign In for Pricing
View Details
Gadolinium (III) Oxide
TRC-G125753-25G 25 g

Gadolinium (III) Oxide

Sign In for Pricing
View Details
WNT11 Human Gene Knockout Kit (CRISPR)
KN219688RB 1 Kit

WNT11 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HMGB3 Recombinant Rabbit Monoclonal Antibody [JE63-39]
HA722033 100 µL

HMGB3 Recombinant Rabbit Monoclonal Antibody [JE63-39]

Sign In for Pricing
View Details