Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Insect Glutathione S-transferase protein

This Insect Glutathione S-transferase protein spans the amino acid sequence from region 2-204aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GST class-sigma Major allergen Bla g 5 Allergen, Bla g 5

UniProt

O18598

Expression Region

2-204aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Blattella germanica (German cockroach) (Blatta germanica)

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APSYKLTYCPVKALGEPIRFLLSYGEKDFEDYRFQEGDWPNLKPSMPFGKTPVLEIDGKQTHQSVAISRYLGKQFGLSGKDDWENLEIDMIVDTISDFRAAIANYHYDADENSKQKKWDPLKKETIPYYTKKFDEVVKANGGYLAAGKLTWADFYFVAILDYLNHMAKEDLVANQPNLKALREKVLGLPAIKAWVAKRPPTDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Laflunimus Sodium Salt
TRC-L168510-50MG 50 mg

Laflunimus Sodium Salt

Sign In for Pricing
View Details
PIK3R1 Antibody
KC-6264-01 50 μL

PIK3R1 Antibody

Sign In for Pricing
View Details
PIK3R1 Antibody
KC-6264-02 100 µL

PIK3R1 Antibody

Sign In for Pricing
View Details
PIK3R1 Antibody
KC-6264-03 1 mL

PIK3R1 Antibody

Sign In for Pricing
View Details
Human Potassium Inwardly Rectifying Channel Subfamily J, Member 10 (KCNJ10) ELISA Kit
RD-KCNJ10-Hu-01 96 Tests

Human Potassium Inwardly Rectifying Channel Subfamily J, Member 10 (KCNJ10) ELISA Kit

Sign In for Pricing
View Details
Human Potassium Inwardly Rectifying Channel Subfamily J, Member 10 (KCNJ10) ELISA Kit
RD-KCNJ10-Hu-02 48 Tests

Human Potassium Inwardly Rectifying Channel Subfamily J, Member 10 (KCNJ10) ELISA Kit

Sign In for Pricing
View Details