Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Insect Glutathione S-transferase protein

This Insect Glutathione S-transferase protein spans the amino acid sequence from region 2-204aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GST class-sigma Major allergen Bla g 5 Allergen, Bla g 5

UniProt

O18598

Expression Region

2-204aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Blattella germanica (German cockroach) (Blatta germanica)

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APSYKLTYCPVKALGEPIRFLLSYGEKDFEDYRFQEGDWPNLKPSMPFGKTPVLEIDGKQTHQSVAISRYLGKQFGLSGKDDWENLEIDMIVDTISDFRAAIANYHYDADENSKQKKWDPLKKETIPYYTKKFDEVVKANGGYLAAGKLTWADFYFVAILDYLNHMAKEDLVANQPNLKALREKVLGLPAIKAWVAKRPPTDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACE2 Recombinant Rabbit monoclonal Antibody
HA750264 100 µL

ACE2 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Ornithine Decarboxylase-1 (ODC-1) (ODC1/2878R), CF640R conjugate, 0.1mg/mL
BNC402878-500 1x 500 µL

Ornithine Decarboxylase-1 (ODC-1) (ODC1/2878R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
N-(2-Chlorobenzyl)-2-(2-thienyl)ethylamine Hydrochloride
TRC-C375190-1G 1 g

N-(2-Chlorobenzyl)-2-(2-thienyl)ethylamine Hydrochloride

Sign In for Pricing
View Details
Human TMEM39B activation kit by CRISPRa
GA110527 1 Kit

Human TMEM39B activation kit by CRISPRa

Sign In for Pricing
View Details
PE Anti-Mouse CD45R (B220) Antibody[RA3-6B2]
AN00428D-01 50 Tests

PE Anti-Mouse CD45R (B220) Antibody[RA3-6B2]

Sign In for Pricing
View Details
PE Anti-Mouse CD45R (B220) Antibody[RA3-6B2]
AN00428D-02 100 Tests

PE Anti-Mouse CD45R (B220) Antibody[RA3-6B2]

Sign In for Pricing
View Details