Mouse Dlk2 protein
This Mouse Dlk2 protein spans the amino acid sequence from region 27-305aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Endothelial cell-specific protein S-1 Epidermal growth factor-like protein 9 Short name, EGF-like protein 9
UniProt
Q8K1E3
Expression Region
27-305aa
Tag
N-terminal 6xHis-tagged
Source
Yeast
Origin
Mus musculus (Mouse)
Field of Research
Signal Transduction
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
31.6 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
This is His-tag protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
DDCSSHCDLAHGCCAPDGSCRCDPGWEGLHCERCVRMPGCQHGTCHQPWQCICHSGWAGKFCDKDEHICTSQSPCQNGGQCVYDGGGEYHCVCLPGFHGRGCERKAGPCEQAGFPCRNGGQCQDNQGFALNFTCRCLAGFMGAHCEVNVDDCLMRPCANGATCIDGINRFSCLCPEGFAGRFCTINLDDCASRPCQRGARCRDRVHDFDCLCPSGYGGKTCELVLPAPEPASVGTPQMPTSAVVVPATGPAPHSAGAGLLRISVKEVVRRQESGLGESS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6403484-01 0.1 mL
Endostatin (Collagen alpha-1(XVIII) Chain, COL18A1) (MaxLight 490)
Sign In for Pricing
View Details MBS6403484-02 5x 0.1 mL
Endostatin (Collagen alpha-1(XVIII) Chain, COL18A1) (MaxLight 490)
Sign In for Pricing
View Details 
TRV-0022702-01 200 µL
Biotin-Linked Polyclonal Antibody to Osteonectin (ON)
Sign In for Pricing
View Details TRV-0022702-02 1 mL
Biotin-Linked Polyclonal Antibody to Osteonectin (ON)
Sign In for Pricing
View Details 
EK12F856-01 48 Test
Goat Tissue Inhibitors of Metalloproteinase 3 (TIMP3) ELISA Kit-Sandwich
Sign In for Pricing
View Details EK12F856-02 96 Tests
Goat Tissue Inhibitors of Metalloproteinase 3 (TIMP3) ELISA Kit-Sandwich
Sign In for Pricing
View Details