Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Dlk2 protein

This Mouse Dlk2 protein spans the amino acid sequence from region 27-305aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Endothelial cell-specific protein S-1 Epidermal growth factor-like protein 9 Short name, EGF-like protein 9

UniProt

Q8K1E3

Expression Region

27-305aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DDCSSHCDLAHGCCAPDGSCRCDPGWEGLHCERCVRMPGCQHGTCHQPWQCICHSGWAGKFCDKDEHICTSQSPCQNGGQCVYDGGGEYHCVCLPGFHGRGCERKAGPCEQAGFPCRNGGQCQDNQGFALNFTCRCLAGFMGAHCEVNVDDCLMRPCANGATCIDGINRFSCLCPEGFAGRFCTINLDDCASRPCQRGARCRDRVHDFDCLCPSGYGGKTCELVLPAPEPASVGTPQMPTSAVVVPATGPAPHSAGAGLLRISVKEVVRRQESGLGESS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Cysteine and glycine-rich protein 2 (CSRP2) ELISA Kit
MBS7231395-01 48 Well

Rat Cysteine and glycine-rich protein 2 (CSRP2) ELISA Kit

Sign In for Pricing
View Details
Rat Cysteine and glycine-rich protein 2 (CSRP2) ELISA Kit
MBS7231395-02 96 Well

Rat Cysteine and glycine-rich protein 2 (CSRP2) ELISA Kit

Sign In for Pricing
View Details
Rat Cysteine and glycine-rich protein 2 (CSRP2) ELISA Kit
MBS7231395-03 5x 96 Well

Rat Cysteine and glycine-rich protein 2 (CSRP2) ELISA Kit

Sign In for Pricing
View Details
Rat Cysteine and glycine-rich protein 2 (CSRP2) ELISA Kit
MBS7231395-04 10x 96 Well

Rat Cysteine and glycine-rich protein 2 (CSRP2) ELISA Kit

Sign In for Pricing
View Details
CERS6 discontinued
387430 200 µL

CERS6 discontinued

Sign In for Pricing
View Details
Bovine odd-skipped related 2 (Drosophila) ELISA Kit
OM620358 96 Strip Well

Bovine odd-skipped related 2 (Drosophila) ELISA Kit

Sign In for Pricing
View Details