Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Insect PNTx4 protein

This Insect PNTx4 protein spans the amino acid sequence from region 35-82aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Insecticidal neurotoxin Tx4 (6-1) Short name, PNTx4 (6-1)

UniProt

P59368

Expression Region

35-82aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Phoneutria nigriventer (Brazilian armed spider) (Ctenus nigriventer)

Field of Research

Epigenetics, Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

7.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CGDINAACKEDCDCCGYTTACDCYWSKSCKCREAAIVIYTAPKKKLTC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Adiponectin/ADIPOQ Antibody Picoband®, Dylight594 Conjugate
PA2014-1-Dylight594 100 µg

Anti-Adiponectin/ADIPOQ Antibody Picoband®, Dylight594 Conjugate

Sign In for Pricing
View Details
Cystatin c nano antibody
UB-GEN-12691 100 µL

Cystatin c nano antibody

Sign In for Pricing
View Details
DNAH5 siRNA (h)
sc-92043 10 µM

DNAH5 siRNA (h)

Sign In for Pricing
View Details
Lentiviral mouse Psg27 shRNA (UAS) - Lentiviral mouse Psg27 shRNA (UAS, GFP) plasmid
GTR15150874 1 Vial

Lentiviral mouse Psg27 shRNA (UAS) - Lentiviral mouse Psg27 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Wide mouth, 250ml packaging bottle, PP/HDPE, natual
WMPB250P/WMPB250H 250 PCS/Case

Wide mouth, 250ml packaging bottle, PP/HDPE, natual

Sign In for Pricing
View Details
Human Annexin A8,ANXA8 ELISA KIT
ELI-49204h 96 Tests

Human Annexin A8,ANXA8 ELISA KIT

Sign In for Pricing
View Details