Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Insect PNTx4 protein

This Insect PNTx4 protein spans the amino acid sequence from region 35-82aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Insecticidal neurotoxin Tx4 (6-1) Short name, PNTx4 (6-1)

UniProt

P59368

Expression Region

35-82aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Phoneutria nigriventer (Brazilian armed spider) (Ctenus nigriventer)

Field of Research

Epigenetics, Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

7.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CGDINAACKEDCDCCGYTTACDCYWSKSCKCREAAIVIYTAPKKKLTC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MBD3L2 Human siRNA Oligo Duplex (Locus ID 125997)
SR314891 1 Kit

MBD3L2 Human siRNA Oligo Duplex (Locus ID 125997)

Sign In for Pricing
View Details
FBXO31 sgRNA CRISPR Lentivector (Human) (Target 2)
K0765703 1.0 µg DNA

FBXO31 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
IRX4 (C-Term) Rabbit pAb
MBS8558075-01 0.1 mL

IRX4 (C-Term) Rabbit pAb

Sign In for Pricing
View Details
IRX4 (C-Term) Rabbit pAb
MBS8558075-02 0.1 mL (AF405L)

IRX4 (C-Term) Rabbit pAb

Sign In for Pricing
View Details
IRX4 (C-Term) Rabbit pAb
MBS8558075-03 0.1 mL (AF405S)

IRX4 (C-Term) Rabbit pAb

Sign In for Pricing
View Details
IRX4 (C-Term) Rabbit pAb
MBS8558075-04 0.1 mL (AF610)

IRX4 (C-Term) Rabbit pAb

Sign In for Pricing
View Details