Human TMPRSS2 protein
This Human TMPRSS2 protein spans the amino acid sequence from region 106-492aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
D16Ertd61e protein, Epitheliasin protein, FLJ41954 protein, MGC6821 protein, PP9284 protein, PRSS10 protein, Serine protease 10 protein, TMPRSS2 protein, TMPRSS2 ERG FUSION GENE, INCLUDED protein, TMPRSS2 ETV1 FUSION GENE, INCLUDED protein, TMPS2_HUMAN protein, Transmembrane protease serine 2 catalytic chain protein, Transmembrane protease, serine 2 protein, Transmembrane protease, serine 2, EC 3.4.219 protein
UniProt
O15393
Expression Region
106-492aa
Tag
N-terminal 6xHis-tagged
Source
Yeast
Origin
Homo sapiens (Human)
Field of Research
Cancer Biology
Purity
Greater than 85% as determined by SDS-PAGE.
Bioactivity
1Recombinant Human TMPRSS2 His tag protein enzyme activity is measured by its ability to cleave fluorogenic peptide substrate (Boc-Gln-Ala-Arg-AMC), The Km is 21.93μM. 2Measured by Camostat Mesylate inhibit ratio on TMPRSS2, which can cleave fluorogenic peptide substrate (Boc-Gln-Ala-Arg-AMC) . The Camostat Mesylate inhibit EC50 is 0.03347-0.07945μM.
Form
Liquid or Lyophilized powder
Molecular Weight
44.8 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Protein Length: Extracellular Domain
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
WKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog