Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Cr2 protein

This Mouse Cr2 protein spans the amino acid sequence from region 729-963aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Complement C3d receptor CD_antigen, CD21

UniProt

P19070

Expression Region

729-963aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LYGNEVSYECDEGFYLLGEKSLQCVNDSKGHGSWSGPPPQCLQSSPLTHCPDPEVKHGYKLNKTHSAFSHNDIVHFVCNQGFIMNGSHLIRCHTNNTWLPGVPTCIRKASLGCQSPSTIPNGNHTGGSIARFPPGMSVMYSCYQGFLMAGEARLICTHEGTWSQPPPFCKEVNCSFPEDTNGIQKGFQPGKTYRFGATVTLECEDGYTLEGSPQSQCQDDSQWNPPLALCKYRRW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human COPRS shRNA (UAS) - Lentiviral human COPRS shRNA (UAS, GFP) (25)
GTR15098228 1 Vial

Lentiviral human COPRS shRNA (UAS) - Lentiviral human COPRS shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
B3GNT7 Antibody (Center) Blocking Peptide
MBS9225371-01 0.5 mg

B3GNT7 Antibody (Center) Blocking Peptide

Sign In for Pricing
View Details
B3GNT7 Antibody (Center) Blocking Peptide
MBS9225371-02 5x 0.5 mg

B3GNT7 Antibody (Center) Blocking Peptide

Sign In for Pricing
View Details
Nori® Rat IL-17B ELISA Kit
GR118195 96 Well

Nori® Rat IL-17B ELISA Kit

Sign In for Pricing
View Details
CD83 Rabbit Polyclonal Antibody (Cy5)
orb874626 100 µL

CD83 Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
Lentiviral human MACROH2A2 shRNA (UAS) - Lentiviral human MACROH2A2 shRNA (UAS, iRFP) (25)
GTR15091430 1 Vial

Lentiviral human MACROH2A2 shRNA (UAS) - Lentiviral human MACROH2A2 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details