Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plant CDKB1-2 protein

This Plant CDKB1-2 protein spans the amino acid sequence from region 1-311aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Short name, CDKB1, 2

UniProt

Q2V419

Expression Region

1-311aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Arabidopsis thaliana (Mouse-ear cress)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEKYEKLEKVGEGTYGKVYKAMEKTTGKLVALKKTRLEMDEEGIPPTALREISLLQMLSQSIYIVRLLCVEHVIQSKDSTVSHSPKSNLYLVFEYLDTDLKKFIDSHRKGSNPRPLEASLVQRFMFQLFKGVAHCHSHGVLHRDLKPQNLLLDKDKGILKIADLGLSRAFTVPLKAYTHEIVTLWYRAPEVLLGSTHYSTAVDIWSVGCIFAEMIRRQALFPGDSEFQQLLHIFRLLGTPTEQQWPGVMALRDWHVYPKWEPQDLSRAVPSLSPEGIDLLTQMLKYNPAERISAKAALDHPYFDSLDKSQF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Spermatogenesis-associated protein 2-Like protein (SPATA2L) Human ELISA Kit
H2701 96 Tests

Spermatogenesis-associated protein 2-Like protein (SPATA2L) Human ELISA Kit

Sign In for Pricing
View Details
PSMG2 Human Pre-designed siRNA Set A
HY-RS11337 1 Set

PSMG2 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
Dot1l 3'UTR Luciferase Stable Cell Line
TU203589 1.0 mL

Dot1l 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Compound NP-020076
T129006-01 10 mg

Compound NP-020076

Sign In for Pricing
View Details
Compound NP-020076
T129006-02 1 g

Compound NP-020076

Sign In for Pricing
View Details
Compound NP-020076
T129006-03 1 mg

Compound NP-020076

Sign In for Pricing
View Details