Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human KCNK2 protein

This Human KCNK2 protein spans the amino acid sequence from region 1-143aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Outward rectifying potassium channel protein TREK-1 TREK-1 K (+) channel subunit Two pore domain potassium channel TREK-1 Two pore potassium channel TPKC1

UniProt

O95069

Expression Region

1-143aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MLPSASRERPGYRAGVAAPDLLDPKSAAQNSKPRLSFSTKPTVLASRVESDTTINVMKWKTVSTIFLVVVLYLIIGATVFKALEQPHEISQRTTIVIQKQTFISQHSCVNSTELDELIQQIVAAINAGIIPLGNTSNQISHWD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIRC91 Protein Vector (Human) (pPB-N-His)
PV111531 500 ng

PIRC91 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Rabbit Polyclonal (IgG) to Human SLC2A3 / GLUT3
MBS246979-01 0.05 mL

Rabbit Polyclonal (IgG) to Human SLC2A3 / GLUT3

Sign In for Pricing
View Details
Rabbit Polyclonal (IgG) to Human SLC2A3 / GLUT3
MBS246979-02 5x 0.05 mL

Rabbit Polyclonal (IgG) to Human SLC2A3 / GLUT3

Sign In for Pricing
View Details
Igdcc3 Mouse shRNA Lentiviral Particle (Locus ID 19289)
TL516581V 500 µL Each

Igdcc3 Mouse shRNA Lentiviral Particle (Locus ID 19289)

Sign In for Pricing
View Details
mEH Double Nickase Plasmid (m)
sc-420203-NIC 20 µg

mEH Double Nickase Plasmid (m)

Sign In for Pricing
View Details
HDAC5 Antibody
MBS852752-01 0.1 mg

HDAC5 Antibody

Sign In for Pricing
View Details