Fish TGFB1 protein
This Fish TGFB1 protein spans the amino acid sequence from region 271-382aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Short name, TGF-beta-1
UniProt
O93449
Expression Region
271-382aa
Tag
N-terminal 6xHis-tagged
Source
Yeast
Origin
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
Field of Research
Signal Transduction
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
15 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
This is His-tag protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
QTTTEEICSDKSESCCVRKLYIDFRKDLGWKWIHEPTGYFANYCIGPCTYIWNTENKYSQVLALYKHHNPGASAQPCCVPQVLEPLPIIYYVGRQHKVEQLSNMIVKSCRCS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS9909019-01 48 Well
Human Prostaglandin F Synthase (PGFS) ELISA Kit
Sign In for Pricing
View Details MBS9909019-02 96 Well
Human Prostaglandin F Synthase (PGFS) ELISA Kit
Sign In for Pricing
View Details MBS9909019-03 5x 96 Well
Human Prostaglandin F Synthase (PGFS) ELISA Kit
Sign In for Pricing
View Details MBS9909019-04 10x 96 Well
Human Prostaglandin F Synthase (PGFS) ELISA Kit
Sign In for Pricing
View Details 
MBS2028383-01 0.1 mL
Polyclonal Antibody to Carbonic Anhydrase III, Muscle Specific (CA3)
Sign In for Pricing
View Details