Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SFTPD protein

This Human SFTPD protein spans the amino acid sequence from region 21-375aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Collectin-7 Lung surfactant protein D

UniProt

P35247

Expression Region

21-375aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AEMKTYSHRTMPSACTLVMCSSVESGLPGRDGRDGREGPRGEKGDPGLPGAAGQAGMPGQAGPVGPKGDNGSVGEPGPKGDTGPSGPPGPPGVPGPAGREGPLGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSAGARGLAGPKGERGVPGERGVPGNTGAAGSAGAMGPQGSPGARGPPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNASE3 Polyclonal Antibody
E914489 100 µL

RNASE3 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-MRPL9 Antibody
MBS4513793-01 0.05 mL

Rabbit anti-MRPL9 Antibody

Sign In for Pricing
View Details
Rabbit anti-MRPL9 Antibody
MBS4513793-02 0.1 mL

Rabbit anti-MRPL9 Antibody

Sign In for Pricing
View Details
Rabbit anti-MRPL9 Antibody
MBS4513793-03 5x 0.1 mL

Rabbit anti-MRPL9 Antibody

Sign In for Pricing
View Details
Ostf1 3'UTR Luciferase Stable Cell Line
TU215680 1.0 mL

Ostf1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
RHOXF2B siRNA (Human)
CRJ8631-01 15 nmol

RHOXF2B siRNA (Human)

Sign In for Pricing
View Details