Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RCVRN protein

This Human RCVRN protein spans the amino acid sequence from region 2-200aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cancer-associated retinopathy protein Short name, Protein CAR

UniProt

P35243

Expression Region

2-200aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GNSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKMKNA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FRS2 (NM_006654) Human Tagged ORF Clone
RC205842 10 µg

FRS2 (NM_006654) Human Tagged ORF Clone

Sign In for Pricing
View Details
Anti-TESK2  (5D1)
YF-MA17293 100 ug

Anti-TESK2 (5D1)

Sign In for Pricing
View Details
Ethyl 5-Norbornene-2-carboxylate
OR1002841 1 g

Ethyl 5-Norbornene-2-carboxylate

Sign In for Pricing
View Details
KIAA2013 (F-12) FITC
sc-515261 FITC 200 µg/mL

KIAA2013 (F-12) FITC

Sign In for Pricing
View Details
Mdh2 (NM_031151) Rat Tagged Lenti ORF Clone
RR211474L3 10 µg

Mdh2 (NM_031151) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
BCL9L Mouse Monoclonal Antibody
AMM81933-01 1 Each

BCL9L Mouse Monoclonal Antibody

Sign In for Pricing
View Details