Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RCVRN protein

This Human RCVRN protein spans the amino acid sequence from region 2-200aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cancer-associated retinopathy protein Short name, Protein CAR

UniProt

P35243

Expression Region

2-200aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GNSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKMKNA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Septin 2 (SEPT2) (NM_001008492) Human Tagged Lenti ORF Clone
RC211650L3 10 µg

Septin 2 (SEPT2) (NM_001008492) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
OmpS1 Recombinant Protein
OPCA03341-20UG 20 µg

OmpS1 Recombinant Protein

Sign In for Pricing
View Details
pOTB7-HCK Plasmid
PVT26451 2 µg

pOTB7-HCK Plasmid

Sign In for Pricing
View Details
ACOT1/2 (F-6) : m-IgG2a BP-HRP Bundle
sc-548311 1 Kit

ACOT1/2 (F-6) : m-IgG2a BP-HRP Bundle

Sign In for Pricing
View Details
RAB8B Rabbit Polyclonal Antibody (Biotin)
orb458740 100 µL

RAB8B Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
DRP1 (Phospho-Ser637) Antibody
E11-9078A 100 µg -100 µL

DRP1 (Phospho-Ser637) Antibody

Sign In for Pricing
View Details