Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse DRB5 protein

This Mouse DRB5 protein spans the amino acid sequence from region 1-393aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DsRNA-binding protein 5 Short name, AtDRB5

UniProt

Q8GY79

Expression Region

1-393aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Arabidopsis thaliana (Mouse-ear cress)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

45.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MYKNQLQELAQRSCFNLPSYTCIREGPDHAPRFKASVNFNGEIFESPTYCSTLRQAEHAAAEVSLNVLSSRVPSKSLTAKILDETGIYKNLLQETAHRAGLDLPMYTSVRSGSCHFPGFSCTVELAGMTFTGESAKTKKQAEKNAAIAAWSSLKKMSSLDSQDEEKEQEAVARVLSRFKPKEVRRRETTNQWRRRTSQQDSNKDLLIERLRWINLLTNQASSSSSTSTPNQHKNSSFISLIPPPPPPKSSKILPFIQQYKDRSSQEAKTETATEMINSKAKVNETSTRLSKQMPFSDMNRYNFVGGCSVNPYSLAPAVQMRSVIPVFAAPPPKPNPNLNPSSLSSSVNEFTSSNNSCSVLNTPGLGGQEKKNLTREMIKLGSESRILDQTHDS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF445 3'UTR GFP Stable Cell Line
TU079182 1.0 mL

ZNF445 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
RHEB Antibody : HRP (OAPB00303-HRP)
OAPB00303-100UG-HRP 0.1 mg

RHEB Antibody : HRP (OAPB00303-HRP)

Sign In for Pricing
View Details
Map2k2 (NM_023138) Mouse Untagged Clone
MC209716 10 µg

Map2k2 (NM_023138) Mouse Untagged Clone

Sign In for Pricing
View Details
Side Access Racking for 16x 2inch Cryoboxes 235H x 141W x 560D
FRE6152 1 Each

Side Access Racking for 16x 2inch Cryoboxes 235H x 141W x 560D

Sign In for Pricing
View Details
Neurl1b (NM_001142652) Rat Tagged ORF Clone Lentiviral Particle
RR204476L3V 200 µL

Neurl1b (NM_001142652) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Vsir Rat shRNA Plasmid (Locus ID 690899)
TR703749 1 Kit

Vsir Rat shRNA Plasmid (Locus ID 690899)

Sign In for Pricing
View Details