Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse DRB5 protein

This Mouse DRB5 protein spans the amino acid sequence from region 1-393aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DsRNA-binding protein 5 Short name, AtDRB5

UniProt

Q8GY79

Expression Region

1-393aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Arabidopsis thaliana (Mouse-ear cress)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

45.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MYKNQLQELAQRSCFNLPSYTCIREGPDHAPRFKASVNFNGEIFESPTYCSTLRQAEHAAAEVSLNVLSSRVPSKSLTAKILDETGIYKNLLQETAHRAGLDLPMYTSVRSGSCHFPGFSCTVELAGMTFTGESAKTKKQAEKNAAIAAWSSLKKMSSLDSQDEEKEQEAVARVLSRFKPKEVRRRETTNQWRRRTSQQDSNKDLLIERLRWINLLTNQASSSSSTSTPNQHKNSSFISLIPPPPPPKSSKILPFIQQYKDRSSQEAKTETATEMINSKAKVNETSTRLSKQMPFSDMNRYNFVGGCSVNPYSLAPAVQMRSVIPVFAAPPPKPNPNLNPSSLSSSVNEFTSSNNSCSVLNTPGLGGQEKKNLTREMIKLGSESRILDQTHDS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZKSCAN4, CT (ZKSCAN4, ZNF307, ZNF427, Zinc finger protein with KRAB and SCAN domains 4, P373c6.1, Zinc finger protein 307, Zinc finger protein 427) (FITC)
MBS6365395-01 0.2 mL

ZKSCAN4, CT (ZKSCAN4, ZNF307, ZNF427, Zinc finger protein with KRAB and SCAN domains 4, P373c6.1, Zinc finger protein 307, Zinc finger protein 427) (FITC)

Sign In for Pricing
View Details
ZKSCAN4, CT (ZKSCAN4, ZNF307, ZNF427, Zinc finger protein with KRAB and SCAN domains 4, P373c6.1, Zinc finger protein 307, Zinc finger protein 427) (FITC)
MBS6365395-02 5x 0.2 mL

ZKSCAN4, CT (ZKSCAN4, ZNF307, ZNF427, Zinc finger protein with KRAB and SCAN domains 4, P373c6.1, Zinc finger protein 307, Zinc finger protein 427) (FITC)

Sign In for Pricing
View Details
AGER/RAGE Peptide
DF6405-BP 1 mg

AGER/RAGE Peptide

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Interleukin 6 (IL6)
MBS2037135-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Interleukin 6 (IL6)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Interleukin 6 (IL6)
MBS2037135-02 0.2 mL

APC/CY7-Linked Polyclonal Antibody to Interleukin 6 (IL6)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Interleukin 6 (IL6)
MBS2037135-03 0.5 mL

APC/CY7-Linked Polyclonal Antibody to Interleukin 6 (IL6)

Sign In for Pricing
View Details