Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse DRB5 protein

This Mouse DRB5 protein spans the amino acid sequence from region 1-393aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DsRNA-binding protein 5 Short name, AtDRB5

UniProt

Q8GY79

Expression Region

1-393aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Arabidopsis thaliana (Mouse-ear cress)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

45.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MYKNQLQELAQRSCFNLPSYTCIREGPDHAPRFKASVNFNGEIFESPTYCSTLRQAEHAAAEVSLNVLSSRVPSKSLTAKILDETGIYKNLLQETAHRAGLDLPMYTSVRSGSCHFPGFSCTVELAGMTFTGESAKTKKQAEKNAAIAAWSSLKKMSSLDSQDEEKEQEAVARVLSRFKPKEVRRRETTNQWRRRTSQQDSNKDLLIERLRWINLLTNQASSSSSTSTPNQHKNSSFISLIPPPPPPKSSKILPFIQQYKDRSSQEAKTETATEMINSKAKVNETSTRLSKQMPFSDMNRYNFVGGCSVNPYSLAPAVQMRSVIPVFAAPPPKPNPNLNPSSLSSSVNEFTSSNNSCSVLNTPGLGGQEKKNLTREMIKLGSESRILDQTHDS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pgp9.5 (UCHL-1) (UCHL1/775), CF405S conjugate, 0.1mg/mL
BNC040775-500 1x 500 µL

Pgp9.5 (UCHL-1) (UCHL1/775), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Anti- Human /Mouse /Rat Full length Polyclonal Antibody
E53P07499 100 µL

Anti- Human /Mouse /Rat Full length Polyclonal Antibody

Sign In for Pricing
View Details
H2-M10.4 siRNA Oligos set (Mouse)
58508174 3x 5 nmol

H2-M10.4 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
APC/iFluor® 700 Anti-human CD11a Antibody *HI111*
101101F2-AAT 500 Tests

APC/iFluor® 700 Anti-human CD11a Antibody *HI111*

Sign In for Pricing
View Details
SCUBE1 Protein Vector (Mouse) (pPM-C-HA)
PV227176 500 ng

SCUBE1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
CD43 (T Cell Marker, Leukosialin, Sialophorin, or Leukocyte Sialoglycoprotein) (APC)
C2397-76P-APC 100 µL

CD43 (T Cell Marker, Leukosialin, Sialophorin, or Leukocyte Sialoglycoprotein) (APC)

Sign In for Pricing
View Details