Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse DRB5 protein

This Mouse DRB5 protein spans the amino acid sequence from region 1-393aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DsRNA-binding protein 5 Short name, AtDRB5

UniProt

Q8GY79

Expression Region

1-393aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Arabidopsis thaliana (Mouse-ear cress)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

45.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MYKNQLQELAQRSCFNLPSYTCIREGPDHAPRFKASVNFNGEIFESPTYCSTLRQAEHAAAEVSLNVLSSRVPSKSLTAKILDETGIYKNLLQETAHRAGLDLPMYTSVRSGSCHFPGFSCTVELAGMTFTGESAKTKKQAEKNAAIAAWSSLKKMSSLDSQDEEKEQEAVARVLSRFKPKEVRRRETTNQWRRRTSQQDSNKDLLIERLRWINLLTNQASSSSSTSTPNQHKNSSFISLIPPPPPPKSSKILPFIQQYKDRSSQEAKTETATEMINSKAKVNETSTRLSKQMPFSDMNRYNFVGGCSVNPYSLAPAVQMRSVIPVFAAPPPKPNPNLNPSSLSSSVNEFTSSNNSCSVLNTPGLGGQEKKNLTREMIKLGSESRILDQTHDS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyproterone Acetate
S2042-250mg 250 mg

Cyproterone Acetate

Sign In for Pricing
View Details
NT5C1A Recombinant Protein (Human)
RP041767 100 µg

NT5C1A Recombinant Protein (Human)

Sign In for Pricing
View Details
4-Hydroxy-2,6-dimethylacetanilide
013679 10 mg

4-Hydroxy-2,6-dimethylacetanilide

Sign In for Pricing
View Details
Anti-Clostridium dificile Toxin A antibody
STJ16101048 100 µg

Anti-Clostridium dificile Toxin A antibody

Sign In for Pricing
View Details
Mouse Monoclonal TROY/TNFRSF19 Antibody (933202) [Janelia Fluor 525]
FAB15481JF525 0.1 mL

Mouse Monoclonal TROY/TNFRSF19 Antibody (933202) [Janelia Fluor 525]

Sign In for Pricing
View Details
Recombinant Campylobacter Jejuni trpB Protein (aa 1-392) (strain 81-176)
VAng-Ly2468-50gEcoli 50 µg (E. coli)

Recombinant Campylobacter Jejuni trpB Protein (aa 1-392) (strain 81-176)

Sign In for Pricing
View Details