Viral HA protein
This Viral HA protein spans the amino acid sequence from region 330-550aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
HA, Hemagglutinin [Cleaved into, Hemagglutinin HA1 chain, Hemagglutinin HA2 chain], Fragment
UniProt
P03441
Expression Region
330-550aa
Tag
N-terminal 6xHis-tagged
Source
Yeast
Origin
Influenza A virus (strain A/Bangkok/1/1979 H3N2)
Field of Research
Infectious Disease & Virology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
27.3 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
This is His-tag protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
GIFGAIAGFIENGWEGMSSGWYGFRHQNSEGTGQAADLKSTQAAIDQINGKLNRVIEKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFEKTRRQLRENAEDMGNGCFKIYHKCDNACIGSIRNGTYDHDVYRDEALNNRFQIKGVELKSGYKDWILWISFAISCFLLCVVLLGFIMVSCQKGNIRCNICI
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC042983-100 1x 100 µL
Neurofilament (NF-L) (Neuronal Marker) (NEFL/2983R), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC683526-100 1x 100 µL
CD31 / PECAM-1 (Endothelial Cell Marker) (PECAM1/3526), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940806-500 1x 500 µL
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC471797-500 1x 500 µL
Histone H1 (Nuclear Marker) (r1415-1), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 