Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Viral HA protein

This Viral HA protein spans the amino acid sequence from region 330-550aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

HA, Hemagglutinin [Cleaved into, Hemagglutinin HA1 chain, Hemagglutinin HA2 chain], Fragment

UniProt

P03441

Expression Region

330-550aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Influenza A virus (strain A/Bangkok/1/1979 H3N2)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GIFGAIAGFIENGWEGMSSGWYGFRHQNSEGTGQAADLKSTQAAIDQINGKLNRVIEKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFEKTRRQLRENAEDMGNGCFKIYHKCDNACIGSIRNGTYDHDVYRDEALNNRFQIKGVELKSGYKDWILWISFAISCFLLCVVLLGFIMVSCQKGNIRCNICI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Granzyme B (NK/T-Cell Lymphoma Marker) (GZMB/3055), CF594 conjugate, 0.1mg/mL
BNC943055-100 1x 100 µL

Granzyme B (NK/T-Cell Lymphoma Marker) (GZMB/3055), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Perforin-1 (Pore Forming Protein) (Apoptosis Marker) (PRF1/2470), CF647 conjugate, 0.1mg/mL
BNC472470-500 1x 500 µL

Perforin-1 (Pore Forming Protein) (Apoptosis Marker) (PRF1/2470), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human ET-1 (Endothelin 1) CLIA Kit
E-CL-H0064-01 24 Tests

Human ET-1 (Endothelin 1) CLIA Kit

Sign In for Pricing
View Details
Human ET-1 (Endothelin 1) CLIA Kit
E-CL-H0064-02 48 Tests

Human ET-1 (Endothelin 1) CLIA Kit

Sign In for Pricing
View Details
Human ET-1 (Endothelin 1) CLIA Kit
E-CL-H0064-03 96 Tests

Human ET-1 (Endothelin 1) CLIA Kit

Sign In for Pricing
View Details
Recombinant Human Ephrin-A4/EFNA4 Protein (His Tag)
PKSH032391-01 10 µg

Recombinant Human Ephrin-A4/EFNA4 Protein (His Tag)

Sign In for Pricing
View Details