Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat CU protein

This Rat CU protein spans the amino acid sequence from region 26-100aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Dutch elm disease toxin

UniProt

Q06153

Expression Region

26-100aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Ophiostoma ulmi (Dutch elm disease fungus)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

9.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SDSYDPCTGLLQKSPQCCNTDILGVANLDCHGPPSVPTSPSQFQASCVADGGRSARCCTLSLLGLALVCTDPVGI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNF123 Rabbit pAb (APR27550N)
APR27550N-01 50 µL

RNF123 Rabbit pAb (APR27550N)

Sign In for Pricing
View Details
RNF123 Rabbit pAb (APR27550N)
APR27550N-02 100 µL

RNF123 Rabbit pAb (APR27550N)

Sign In for Pricing
View Details
RNF123 Rabbit pAb (APR27550N)
APR27550N-03 200 µL

RNF123 Rabbit pAb (APR27550N)

Sign In for Pricing
View Details
Mouse TNF-alpha Antibody
34131-05111 150 µg

Mouse TNF-alpha Antibody

Sign In for Pricing
View Details
Alu FlexRack615, 615x140x145mm, w/locking rod
TE20120 1 Piece

Alu FlexRack615, 615x140x145mm, w/locking rod

Sign In for Pricing
View Details
RUNX1 Antibody, Biotin conjugated
CSB-PA862035LD01HU-01 50 µg

RUNX1 Antibody, Biotin conjugated

Sign In for Pricing
View Details