Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat CU protein

This Rat CU protein spans the amino acid sequence from region 26-100aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Dutch elm disease toxin

UniProt

Q06153

Expression Region

26-100aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Ophiostoma ulmi (Dutch elm disease fungus)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

9.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SDSYDPCTGLLQKSPQCCNTDILGVANLDCHGPPSVPTSPSQFQASCVADGGRSARCCTLSLLGLALVCTDPVGI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gnl3l siRNA Oligos set (Rat)
22338176 3x 5 nmol

Gnl3l siRNA Oligos set (Rat)

Sign In for Pricing
View Details
Canine Carbonic Anhydrase VB, Mitochondrial ELISA Kit
MBS101448-01 48 Well

Canine Carbonic Anhydrase VB, Mitochondrial ELISA Kit

Sign In for Pricing
View Details
Canine Carbonic Anhydrase VB, Mitochondrial ELISA Kit
MBS101448-02 96 Well

Canine Carbonic Anhydrase VB, Mitochondrial ELISA Kit

Sign In for Pricing
View Details
Canine Carbonic Anhydrase VB, Mitochondrial ELISA Kit
MBS101448-03 5x 96 Well

Canine Carbonic Anhydrase VB, Mitochondrial ELISA Kit

Sign In for Pricing
View Details
Canine Carbonic Anhydrase VB, Mitochondrial ELISA Kit
MBS101448-04 10x 96 Well

Canine Carbonic Anhydrase VB, Mitochondrial ELISA Kit

Sign In for Pricing
View Details
CRBN Polyclonal Antibody, APC Conjugated
bs-11716R-APC 100 µL

CRBN Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details