Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Insect DERF2 protein

This Insect DERF2 protein spans the amino acid sequence from region 18-146aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Allergen Der f II Allergen, Der f 2

UniProt

Q00855

Expression Region

18-146aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Dermatophagoides farinae (American house dust mite)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat GPHN Protein, His (Fc)-Avi-tagged
GPHN-2293R 50 µg

Recombinant Rat GPHN Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
TNFRSF11B Antibody
CSB-PA003597-01 50 µg

TNFRSF11B Antibody

Sign In for Pricing
View Details
TNFRSF11B Antibody
CSB-PA003597-02 100 µg

TNFRSF11B Antibody

Sign In for Pricing
View Details
Human CD227/MUC1 Antibody , FITC
E55A07288 50 Tests

Human CD227/MUC1 Antibody , FITC

Sign In for Pricing
View Details
OR6K3 ORF Vector (Human) (pORF)
35514011 1.0 µg DNA

OR6K3 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
FAM50B (NM_012135) Human Untagged Clone
SC115529 10 µg

FAM50B (NM_012135) Human Untagged Clone

Sign In for Pricing
View Details