Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Hapln1 protein

This Mouse Hapln1 protein spans the amino acid sequence from region 10-356aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cartilage-linking protein 1 Short name, Cartilage-link protein Proteoglycan link protein

UniProt

Q9QUP5

Expression Region

10-356aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ISVCWADHHLSDSYTPPDQDRVIHIQAENGPRLLVEAEQAKVFSHRGGNVTLPCKFYRDPTAFGSGIHKIRIKWTKLTSDYLREVDVFVSMGYHKKTYGGYQGRVFLKGGSDNDASLVITDLTLEDYGRYKCEVIEGLEDDTAVVALELQGVVFPYFPRLGRYNLNFHEARQACLDQDAVIASFDQLYDAWRGGLDWCNAGWLSDGSVQYPITKPREPCGGQNTVPGVRNYGFWDKDKSRYDVFCFTSNFNGRFYYLIHPTKLTYDEAVQACLNDGAQIAKVGQIFAAWKLLGYDRCDAGWLADGSVRYPISRPRRRCSPTEAAVRFVGFPDKKHKLYGVYCFRAYN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Flt3 3'UTR GFP Stable Cell Line
TU156624 1.0 mL

Flt3 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Chicken C-Peptide,connecting peptide ELISA Kit
CELI-66099c 96 Tests

Chicken C-Peptide,connecting peptide ELISA Kit

Sign In for Pricing
View Details
Rabbit MCP/CD46 (Membrane Cofactor Protein) ELISA Kit
MBS2513782-01 24 Tests

Rabbit MCP/CD46 (Membrane Cofactor Protein) ELISA Kit

Sign In for Pricing
View Details
Rabbit MCP/CD46 (Membrane Cofactor Protein) ELISA Kit
MBS2513782-02 48 Tests

Rabbit MCP/CD46 (Membrane Cofactor Protein) ELISA Kit

Sign In for Pricing
View Details
Rabbit MCP/CD46 (Membrane Cofactor Protein) ELISA Kit
MBS2513782-03 96 Tests

Rabbit MCP/CD46 (Membrane Cofactor Protein) ELISA Kit

Sign In for Pricing
View Details
Rabbit MCP/CD46 (Membrane Cofactor Protein) ELISA Kit
MBS2513782-04 5x 96 Tests

Rabbit MCP/CD46 (Membrane Cofactor Protein) ELISA Kit

Sign In for Pricing
View Details