Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TLR1 protein

This Human TLR1 protein spans the amino acid sequence from region 25-580aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Toll/interleukin-1 receptor-like protein Short name, TIL CD_antigen, CD281

UniProt

Q15399

Expression Region

25-580aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

65.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SEFLVDRSKNGLIHVPKDLSQKTTILNISQNYISELWTSDILSLSKLRILIISHNRIQYLDISVFKFNQELEYLDLSHNKLVKISCHPTVNLKHLDLSFNAFDALPICKEFGNMSQLKFLGLSTTHLEKSSVLPIAHLNISKVLLVLGETYGEKEDPEGLQDFNTESLHIVFPTNKEFHFILDVSVKTVANLELSNIKCVLEDNKCSYFLSILAKLQTNPKLSNLTLNNIETTWNSFIRILQLVWHTTVWYFSISNVKLQGQLDFRDFDYSGTSLKALSIHQVVSDVFGFPQSYIYEIFSNMNIKNFTVSGTRMVHMLCPSKISPFLHLDFSNNLLTDTVFENCGHLTELETLILQMNQLKELSKIAEMTTQMKSLQQLDISQNSVSYDEKKGDCSWTKSLLSLNMSSNILTDTIFRCLPPRIKVLDLHSNKIKSIPKQVVKLEALQELNVAFNSLTDLPGCGSFSSLSVLIIDHNSVSHPSADFFQSCQKMRSIKAGDNPFQCTCELGEFVKNIDQVSSEVLEGWPDSYKCDYPESYRGTLLKDFHMSELSCNIT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Deacetoxytaxinine J
orb1683774 5 mg

2-Deacetoxytaxinine J

Sign In for Pricing
View Details
Glycyl-L-glutamine monohydrate
GH2981-1g 1 g

Glycyl-L-glutamine monohydrate

Sign In for Pricing
View Details
Lentiviral human MND1 shRNA (UAS) - Lentiviral human MND1 shRNA (UAS, RFP) plasmid
GTR15325444 1 Vial

Lentiviral human MND1 shRNA (UAS) - Lentiviral human MND1 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
C8orf66 3'UTR GFP Stable Cell Line
TU052541 1.0 mL

C8orf66 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Myostatin (MSTN)
MBS2057522-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Myostatin (MSTN)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Myostatin (MSTN)
MBS2057522-02 0.2 mL

APC/CY7-Linked Polyclonal Antibody to Myostatin (MSTN)

Sign In for Pricing
View Details