What is the catalog number for Viral C3L protein?

The catalog number for Viral C3L protein is orb358466.

What sizes are available for Viral C3L protein?

Viral C3L protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Viral C3L protein come in?

Viral C3L protein is available in 3 different pack sizes.

Is Viral C3L protein in stock?

Viral C3L protein is currently made to order / not held in immediate stock. Contact us for lead time.

Viral C3L protein

This Viral C3L protein spans the amino acid sequence from region 20-263aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

28KDA protein Secretory protein 35 Short name, Protein C3 VCP

UniProt

P68638

Expression Region

20-263aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR) )

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CCTIPSRPINMKFKNSVETDANANYNIGDTIEYLCLPGYRKQKMGPIYAKCTGTGWTLFNQCIKRRCPSPRDIDNGQLDIGGVDFGSSITYSCNSGYHLIGESKSYCELGSTGSMVWNPEAPICESVKCQSPPSISNGRHNGYEDFYTDGSVVTYSCNSGYSLIGNSGVLCSGGEWSDPPTCQIVKCPHPTISNGYLSSGFKRSYSYNDNVDFKCKYGYKLSGSSSSTCSPGNTWKPELPKCVR