Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Viral C3L protein

This Viral C3L protein spans the amino acid sequence from region 20-263aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

28KDA protein Secretory protein 35 Short name, Protein C3 VCP

UniProt

P68638

Expression Region

20-263aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR) )

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CCTIPSRPINMKFKNSVETDANANYNIGDTIEYLCLPGYRKQKMGPIYAKCTGTGWTLFNQCIKRRCPSPRDIDNGQLDIGGVDFGSSITYSCNSGYHLIGESKSYCELGSTGSMVWNPEAPICESVKCQSPPSISNGRHNGYEDFYTDGSVVTYSCNSGYSLIGNSGVLCSGGEWSDPPTCQIVKCPHPTISNGYLSSGFKRSYSYNDNVDFKCKYGYKLSGSSSSTCSPGNTWKPELPKCVR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sall2 3'UTR Lenti-reporter-Luc Vector
42979084 1.0 µg

Sall2 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Integrin alpha V beta 6
045863 100 µg

Integrin alpha V beta 6

Sign In for Pricing
View Details
UEVLD Antibody
E51A04648 100 µL

UEVLD Antibody

Sign In for Pricing
View Details
Mouse Anti-Bovine IgG Antibody (AcalephFluor633)
orb2987326-01 100 µL

Mouse Anti-Bovine IgG Antibody (AcalephFluor633)

Sign In for Pricing
View Details
Mouse Anti-Bovine IgG Antibody (AcalephFluor633)
orb2987326-02 500 µL

Mouse Anti-Bovine IgG Antibody (AcalephFluor633)

Sign In for Pricing
View Details
Mouse Anti-Bovine IgG Antibody (AcalephFluor633)
orb2987326-03 1 mL

Mouse Anti-Bovine IgG Antibody (AcalephFluor633)

Sign In for Pricing
View Details