Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human NANOG protein

This Human NANOG protein spans the amino acid sequence from region 1-305aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Homeobox transcription factor Nanog Short name, hNanog

UniProt

Q9H9S0

Expression Region

1-305aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSVDPACPQSLPCFEASDCKESSPMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDLLIQDSPDSSTSPKGKQPTSAEKSVAKKEDKVPVKKQKTRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKNNWPKNSNGVTQKASAPTYPSLYSSYHQGCLVNPTGNLPMWSNQTWNNSTWSNQTQNIQSWSNHSWNTQTWCTQSWNNQAWNSPFYNCGEESLQSCMQFQPNSPASDLEAALEAAGEGLNVIQQTTRYFSTPQTMDLFLNYSMNMQPEDV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRCP (NM_005040) Human Over-expression Lysate
LS005547-100ug 100 µg

PRCP (NM_005040) Human Over-expression Lysate

Sign In for Pricing
View Details
KCNK9 Polyclonal Antibody
MBS2554255-01 0.06 mL

KCNK9 Polyclonal Antibody

Sign In for Pricing
View Details
KCNK9 Polyclonal Antibody
MBS2554255-02 0.12 mL

KCNK9 Polyclonal Antibody

Sign In for Pricing
View Details
KCNK9 Polyclonal Antibody
MBS2554255-03 0.2 mL

KCNK9 Polyclonal Antibody

Sign In for Pricing
View Details
KCNK9 Polyclonal Antibody
MBS2554255-04 5x 0.2 mL

KCNK9 Polyclonal Antibody

Sign In for Pricing
View Details
TERF1 Polyclonal Antibody
MBS9125946-01 0.02 mL

TERF1 Polyclonal Antibody

Sign In for Pricing
View Details