Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human APOB protein

This Human APOB protein spans the amino acid sequence from region 28-127aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Apolipoprotein B-48 Short name, Apo B-48

UniProt

P04114

Expression Region

28-127aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EEEMLENVSLVCPKDATRFKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSEEFAAAMS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P75 NGF Receptor (NGFR) (NM_002507) Human Over-expression Lysate
LS004804-20ug 20 µg

P75 NGF Receptor (NGFR) (NM_002507) Human Over-expression Lysate

Sign In for Pricing
View Details
NDUFV1 Blocking peptide
orb1441694 500 µg

NDUFV1 Blocking peptide

Sign In for Pricing
View Details
TSGA10 Protein Vector (Mouse) (pPB-C-His)
PV242258 500 ng

TSGA10 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Rat Clstn3 Pre-designed siRNA Set B
SI202923B 1 Each

Rat Clstn3 Pre-designed siRNA Set B

Sign In for Pricing
View Details
rno-miR-219b miRNA Antagomir
MNR01327 2x 5.0 nmol

rno-miR-219b miRNA Antagomir

Sign In for Pricing
View Details
LOC100365859 3'UTR Luciferase Stable Cell Line
TU209663 1.0 mL

LOC100365859 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details