Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human APOB protein

This Human APOB protein spans the amino acid sequence from region 28-127aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Apolipoprotein B-48 Short name, Apo B-48

UniProt

P04114

Expression Region

28-127aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EEEMLENVSLVCPKDATRFKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSEEFAAAMS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

8-oxoguanine DNA glycosydase (hOGG1) Human ELISA Kit
B1537 96 Tests

8-oxoguanine DNA glycosydase (hOGG1) Human ELISA Kit

Sign In for Pricing
View Details
3- (2,2-Difluoroethoxy) benzaldehyde
STA45898-01 250 mg

3- (2,2-Difluoroethoxy) benzaldehyde

Sign In for Pricing
View Details
3- (2,2-Difluoroethoxy) benzaldehyde
STA45898-02 2.5 g

3- (2,2-Difluoroethoxy) benzaldehyde

Sign In for Pricing
View Details
PU141
BA4775-10 10 mg

PU141

Sign In for Pricing
View Details
ZNF558, ID (ZNF558, Zinc finger protein 558) (Azide free) (HRP) discontinued
044281-HRP 200 µL

ZNF558, ID (ZNF558, Zinc finger protein 558) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Interleukin-1 beta
orb1646006-01 50 µg

Interleukin-1 beta

Sign In for Pricing
View Details