Human APOB protein
This Human APOB protein spans the amino acid sequence from region 28-127aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Apolipoprotein B-48 Short name, Apo B-48
UniProt
P04114
Expression Region
28-127aa
Tag
N-terminal 6xHis-tagged
Source
Yeast
Origin
Homo sapiens (Human)
Field of Research
Metabolism Research
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
13.2 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
This is His-tag protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
EEEMLENVSLVCPKDATRFKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSEEFAAAMS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
A02055-1-iFluor647 100 µg
Anti-ASAH1 Picoband® Antibody-iFluor647 Conjugate
Sign In for Pricing
View Details MBS1221798-01 0.02 mg (E-Coli)
Recombinant Yersinia pseudotuberculosis serotype IB Deoxycytidine triphosphate deaminase (dcd)
Sign In for Pricing
View Details MBS1221798-02 0.1 mg (E-Coli)
Recombinant Yersinia pseudotuberculosis serotype IB Deoxycytidine triphosphate deaminase (dcd)
Sign In for Pricing
View Details MBS1221798-03 0.02 mg (Yeast)
Recombinant Yersinia pseudotuberculosis serotype IB Deoxycytidine triphosphate deaminase (dcd)
Sign In for Pricing
View Details MBS1221798-04 0.1 mg (Yeast)
Recombinant Yersinia pseudotuberculosis serotype IB Deoxycytidine triphosphate deaminase (dcd)
Sign In for Pricing
View Details