Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cow CD8A protein

This Cow CD8A protein spans the amino acid sequence from region 26-189aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CD_antigen, CD8a

UniProt

P31783

Expression Region

26-189aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Bos taurus (Bovine)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LSFRMSPTQKETRLGEKVELQCELLQSGMATGCSWLRHIPGDDPRPTFLMYLSAQRVKLAEGLDPRHISGAKVSGTKFQLTLSSFLQEDQGYYFCSVVSNSILYFSNFVPVFLPAKPATTPAMRPSSAAPTSAPQTRSVSPRSEVCRTSAGSAVDTSRLDFACN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Havcr1 shRNA (UAS) - Lentiviral mouse Havcr1 shRNA (UAS) (100)
GTR15225558 1 Vial

Lentiviral mouse Havcr1 shRNA (UAS) - Lentiviral mouse Havcr1 shRNA (UAS) (100)

Sign In for Pricing
View Details
4’-Hydroxy Nimesulide-d3
433980-01 1 mg

4’-Hydroxy Nimesulide-d3

Sign In for Pricing
View Details
4’-Hydroxy Nimesulide-d3
433980-02 10 mg

4’-Hydroxy Nimesulide-d3

Sign In for Pricing
View Details
GENLISA Hamster 4-HNE (4-Hydroxynonenal) ELISA
KLH1017 1x 96 Well

GENLISA Hamster 4-HNE (4-Hydroxynonenal) ELISA

Sign In for Pricing
View Details
Rat Galectin 7 CLIA Kit
IRTGAL7KTC 1 Each

Rat Galectin 7 CLIA Kit

Sign In for Pricing
View Details
FSH-beta (Follicle Stimulating Hormone-beta) Antibody - With BSA and Azide
orb1462594-01 20 µg

FSH-beta (Follicle Stimulating Hormone-beta) Antibody - With BSA and Azide

Sign In for Pricing
View Details