Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cow CD8A protein

This Cow CD8A protein spans the amino acid sequence from region 26-189aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CD_antigen, CD8a

UniProt

P31783

Expression Region

26-189aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Bos taurus (Bovine)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LSFRMSPTQKETRLGEKVELQCELLQSGMATGCSWLRHIPGDDPRPTFLMYLSAQRVKLAEGLDPRHISGAKVSGTKFQLTLSSFLQEDQGYYFCSVVSNSILYFSNFVPVFLPAKPATTPAMRPSSAAPTSAPQTRSVSPRSEVCRTSAGSAVDTSRLDFACN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti LIG1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Immunofluorescence) 200ul
IRBAMLLIG1AP480200UL 200 µL

Rabbit Anti LIG1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Immunofluorescence) 200ul

Sign In for Pricing
View Details
STRCP1 Protein Vector (Human) (pPB-C-His)
PV134034 500 ng

STRCP1 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Recombinant Mouse IL-17A (C-6His)
PHM0987-01 10 µg

Recombinant Mouse IL-17A (C-6His)

Sign In for Pricing
View Details
Recombinant Mouse IL-17A (C-6His)
PHM0987-02 50 µg

Recombinant Mouse IL-17A (C-6His)

Sign In for Pricing
View Details
Recombinant Mouse IL-17A (C-6His)
PHM0987-03 500 µg

Recombinant Mouse IL-17A (C-6His)

Sign In for Pricing
View Details
ZNF740 Rabbit Polyclonal Antibody (PE-Cy5.5)
orb920826 100 µL

ZNF740 Rabbit Polyclonal Antibody (PE-Cy5.5)

Sign In for Pricing
View Details