Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat POL30 protein

This Rat POL30 protein spans the amino acid sequence from region 1-258aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Short name, PCNA

UniProt

P15873

Expression Region

1-258aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Field of Research

Microbiology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MLEAKFEEASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSRVLLVSLEIGVEAFQEYRCDHPVTLGMDLTSLSKILRCGNNTDTLTLIADNTPDSIILLFEDTKKDRIAEYSLKLMDIDADFLKIEELQYDSTLSLPSSEFSKIVRDLSQLSDSINIMITKETIKFVADGDIGSGSVIIKPFVDMEHPETSIKLEMDQPVDLTFGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQFDLKSGFLQFFLAPKFNDEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRRC69 Protein Vector (Mouse) (pPM-C-HA)
PV197808 500 ng

LRRC69 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Mouse Exportin 1 ELISA Kit
MBS077283-01 48 Well

Mouse Exportin 1 ELISA Kit

Sign In for Pricing
View Details
Mouse Exportin 1 ELISA Kit
MBS077283-02 96 Well

Mouse Exportin 1 ELISA Kit

Sign In for Pricing
View Details
Mouse Exportin 1 ELISA Kit
MBS077283-03 5x 96 Well

Mouse Exportin 1 ELISA Kit

Sign In for Pricing
View Details
Mouse Exportin 1 ELISA Kit
MBS077283-04 10x 96 Well

Mouse Exportin 1 ELISA Kit

Sign In for Pricing
View Details
GLUL Protein Vector (Human) (pPB-N-His)
PV017838 500 ng

GLUL Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details